Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Tandoori Chicken Wings

Crispy, spiced chicken wings roasted on a sheet pan with a yogurt-based tandoori marinade. Ready in under 30 minutes with minimal prep and maximum flavor.

Total time
28 min
Servings
4
Calories
412
Protein
38g
Sheet Pan Tandoori Chicken Wings
casualsatisfyingindiangluten-freechickencrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 450°F and wait until the indicator light tells you it has finished heating, about 10 minutes.

  2. Step 2

    Place the Greek yogurt, 3 tablespoons tandoori masala, 3 tablespoons lemon juice, and minced garlic into a large bowl.

  3. Step 3

    Stir with a wooden spoon until the mixture is smooth and uniform, with no streaks or lumps visible, about 1 minute.

  4. Step 4

    Pat the chicken wings dry with paper towels, removing any moisture from the surface so they will crisp better.

  5. Step 5

    Add the dried wings to the yogurt mixture and use your hands or tongs to coat each wing evenly, turning until no raw chicken is visible.

  6. Step 6

    Sprinkle salt and pepper over the coated wings and stir once more to distribute the seasoning evenly.

  7. Step 7

    Spread the wings in a single layer across two sheet pans, spacing them about 1 inch apart so heat circulates around each piece.

  8. Step 8

    Place both pans into the preheated 450°F oven and roast for 18 minutes without moving them.

  9. Step 9

    Remove both pans from the oven; the wings should be deep golden brown with crispy edges and no pink near the joints.

  10. Step 10

    Let the wings rest on the pans for 2 minutes, then slide them onto a serving plate or board.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • paper towels
  • two 18 x 13-inch sheet pans
  • kitchen tongs or hands

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.