Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Fritters

Crispy golden shrimp fritters made with a simple batter and breadcrumbs, perfect for a quick snack or light meal.

Total time
20 min
Servings
2
Calories
420
Protein
20g
Shrimp Fritters
comfortingquickFilipinoshrimpcrispytenderweeknightcasual gathering

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel and devein the 0.5 lb shrimp, then chop into small pieces. In a bowl, mix the shrimp with 0.5 cup flour, 1 egg, and 0.5 tsp salt until well combined.

  2. Step 2

    Shape the mixture into small patties, about 2 inches wide. Press each patty into 0.5 cup breadcrumbs, coating both sides evenly.

  3. Step 3

    Heat 0.5 cup vegetable oil in a skillet over medium-high. Fry the fritters in batches, about 3 minutes per side, until golden brown and crispy. Drain on paper towels and serve hot.

Tools you’ll need

  • skillet
  • mixing bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.