Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Toast with Aioli

Crispy toasted bread topped with garlicky shrimp and a creamy lemon aioli. A quick, satisfying snack or light meal ready in about 20 minutes.

Total time
20 min
Servings
2
Calories
450
Protein
25g
Shrimp Toast with Aioli
comfortingquickamericanshrimpcrispytenderweeknightappetizer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small bowl, mix 1/2 cup mayonnaise, 1 minced garlic clove, and the juice of 1/2 lemon. Season with salt and pepper; set aside.

  2. Step 2

    Pat 8 oz shrimp dry and season with salt and pepper. Heat 2 tbsp olive oil in a skillet over medium-high until shimmering.

  3. Step 3

    Add shrimp in a single layer; cook until pink and opaque, about 2 minutes per side. Remove from heat.

  4. Step 4

    Toast 4 bread slices until golden and crisp. Spread each with the aioli.

  5. Step 5

    Top toast with shrimp, drizzle with remaining aioli, and garnish with lemon zest and fresh herbs if desired.

Tools you’ll need

  • skillet
  • small bowl
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.