Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Panang Curry

A rich, creamy Thai-style curry with tender shrimp, fragrant panang curry paste, and a hint of fresh mint. Ready in about 30 minutes, this comforting dish is perfect for a weeknight dinner.

Total time
30 min
Servings
4
Calories
480
Protein
28g
Shrimp Panang Curry
comfortingsatisfyingThaigluten-freeshrimpcreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a large skillet or wok, heat 1 tbsp of the coconut milk over medium heat until it starts to sizzle, about 1 minute.

  2. Step 2

    Add 3 tbsp panang curry paste and stir-fry until fragrant, about 1-2 minutes, until the paste darkens slightly.

  3. Step 3

    Pour in the remaining coconut milk, 1 tbsp fish sauce, and 1 tbsp brown sugar. Stir to combine and bring to a gentle simmer, about 3-4 minutes, until the sauce thickens slightly.

  4. Step 4

    Add 1 lb shrimp and cook, stirring occasionally, until they turn pink and opaque, about 4-5 minutes. Do not overcook.

  5. Step 5

    Remove from heat and squeeze in the juice of 1 lime. Taste and adjust seasoning if needed.

  6. Step 6

    Serve immediately over 2 cups cooked jasmine rice, garnished with 1/4 cup fresh mint leaves.

Tools you’ll need

  • Large skillet or wok
  • Wooden spoon
  • Measuring cups and spoons
  • Knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.