Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Sushi

Simple homemade shrimp sushi with seasoned rice, fresh shrimp, and a touch of wasabi and pickled ginger. Perfect for a fun weeknight dinner.

Total time
35 min
Servings
2
Calories
350
Protein
20g
Shrimp Sushi
comfortingfunJapanesedairy-freeshrimpchewystickyweeknight dinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the 1 cup sushi rice in cold water until the water runs clear. Combine with 1.25 cups water in a saucepan and bring to a boil.

  2. Step 2

    Reduce heat to low, cover, and simmer until the water is absorbed and rice is tender, about 15 minutes. Remove from heat and let stand, covered, for 10 minutes.

  3. Step 3

    In a small bowl, mix 2 tbsp rice vinegar, 1 tsp sugar, and 0.5 tsp salt until dissolved. Fold this into the warm rice, then let it cool to room temperature.

  4. Step 4

    Bring a small pot of water to a boil. Add the 0.5 lb shrimp and cook until pink and opaque, about 2-3 minutes. Drain and let cool, then slice each shrimp in half lengthwise.

  5. Step 5

    Wet your hands with water to prevent sticking. Take a small handful of rice and shape it into an oval about 2 inches long.

  6. Step 6

    Top each rice oval with a slice of shrimp. Serve with a dab of wasabi and pickled ginger on the side.

  7. Step 7

    Enjoy immediately, or refrigerate for up to 2 hours before serving.

Tools you’ll need

  • saucepan with lid
  • small bowl
  • pot for boiling
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.