Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shrimp Tempura Udon

Crispy tempura shrimp served over silky udon noodles in a savory dashi broth. A restaurant-quality Japanese comfort bowl ready in under an hour.

Total time
45 min
Servings
2
Calories
580
Protein
18g
Shrimp Tempura Udon
comfortsatisfyingjapaneseshrimpcrispytendersilkyweeknight

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  2. Step 2

    Combine flour and cornstarch in a bowl. Keep ice water separate.

  3. Step 3

    Prepare dashi broth according to package directions; stir in mirin and soy sauce.

  4. Step 4

    Heat oil in a heavy pot to 350°F. Use a thermometer to check — oil will shimmer.

  5. Step 5

    Just before frying, whisk ice water into flour mixture until batter looks lumpy.

  6. Step 6

    Dip shrimp into batter; gently place in hot oil. Fry 4–5 shrimp at a time.

  7. Step 7

    Fry shrimp 2–3 minutes per batch until light golden and crispy. Transfer to paper towels.

  8. Step 8

    Boil udon noodles in salted water until tender, ~3 minutes. Drain well.

  9. Step 9

    Divide noodles into bowls. Pour hot broth over noodles, filling three-quarters full.

  10. Step 10

    Arrange fried shrimp on top of noodles. Garnish with scallions.

  11. Step 11

    Serve immediately while tempura is still crispy.

Tools you’ll need

  • heavy-bottomed pot or Dutch oven
  • instant-read thermometer
  • paper towels
  • two mixing bowls
  • whisk
  • slotted spoon
  • kitchen tongs
  • large pot for boiling noodles
  • soup ladle
  • two bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.