Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tempura Shrimp Soba

Crispy tempura shrimp served over chewy soba noodles in a warm, savory dashi broth. A restaurant-quality Japanese noodle dish ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
22g
Tempura Shrimp Soba
comfortsatisfyingjapaneseshrimpcrispychewytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry on both sides using paper towels, pressing gently so they absorb any surface moisture — this helps them crisp better when fried.

  2. Step 2

    Pour the dashi broth into a small pot and place it on the stove over medium heat, uncovered, while you prepare other ingredients.

  3. Step 3

    Pour the cold water into a small bowl and whisk in the flour using a fork until the mixture looks like thin pancake batter with small lumps — do not overmix, as lumpy batter creates crispier tempura.

  4. Step 4

    Fill a medium heavy-bottomed pot or deep skillet two-thirds full with vegetable oil and place it over medium-high heat for 5–7 minutes until the oil shimmers and a tiny piece of batter sizzles immediately when dropped in.

  5. Step 5

    While the oil heats, fill a large pot with water, bring it to a boil over high heat, then add the soba noodles and stir once with chopsticks or a fork so they separate.

  6. Step 6

    Cook the soba for 4–5 minutes until tender but still slightly firm when you bite a strand, then drain in a fine-mesh strainer and set aside.

  7. Step 7

    Working with 3–4 shrimp at a time, dip each shrimp into the batter using a fork to coat all sides, then carefully lower it into the hot oil and fry for 1.5–2 minutes until golden and crispy.

  8. Step 8

    Use a slotted spoon to transfer the fried shrimp to a paper towel–lined plate, leaving about 30 seconds between batches so the oil stays hot and the next batch crisps properly.

  9. Step 9

    Stir the soy sauce into the warm broth in the small pot, tasting and adding 1 teaspoon more soy sauce if it tastes too mild — it should taste savory and salty.

  10. Step 10

    Divide the cooked soba noodles between two bowls, pouring half the hot dashi broth into each bowl.

  11. Step 11

    Arrange 6 pieces of crispy tempura shrimp on top of each bowl and serve immediately while the shrimp are still warm and crunchy.

Tools you’ll need

  • medium heavy-bottomed pot or deep skillet (at least 6 inches diameter)
  • small pot
  • large pot for boiling water
  • fine-mesh strainer
  • small bowl
  • fork or chopsticks
  • slotted spoon
  • paper towels
  • two serving bowls
  • candy thermometer (optional, to verify oil temperature)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.