CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tempura Shrimp Soba

Crispy tempura shrimp served over chewy soba noodles in a warm, savory dashi broth. A restaurant-quality Japanese noodle dish ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
22g
Tempura Shrimp Soba
comfortsatisfyingjapaneseshrimpcrispychewytenderweeknight

Ingredients

  • 8 oz soba noodles (buckwheat)
  • 12 oz large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • ½ cup cold water
  • 3 cups dashi broth (or vegetable broth)
  • 3 tbsp soy sauce
  • 2 cups vegetable oil for frying

Instructions

  1. 1

    Pat the shrimp dry on both sides using paper towels, pressing gently so they absorb any surface moisture — this helps them crisp better when fried.

  2. 2

    Pour the dashi broth into a small pot and place it on the stove over medium heat, uncovered, while you prepare other ingredients.

  3. 3

    Pour the cold water into a small bowl and whisk in the flour using a fork until the mixture looks like thin pancake batter with small lumps — do not overmix, as lumpy batter creates crispier tempura.

  4. 4

    Fill a medium heavy-bottomed pot or deep skillet two-thirds full with vegetable oil and place it over medium-high heat for 5–7 minutes until the oil shimmers and a tiny piece of batter sizzles immediately when dropped in.

  5. 5

    While the oil heats, fill a large pot with water, bring it to a boil over high heat, then add the soba noodles and stir once with chopsticks or a fork so they separate.

  6. 6

    Cook the soba for 4–5 minutes until tender but still slightly firm when you bite a strand, then drain in a fine-mesh strainer and set aside.

  7. 7

    Working with 3–4 shrimp at a time, dip each shrimp into the batter using a fork to coat all sides, then carefully lower it into the hot oil and fry for 1.5–2 minutes until golden and crispy.

  8. 8

    Use a slotted spoon to transfer the fried shrimp to a paper towel–lined plate, leaving about 30 seconds between batches so the oil stays hot and the next batch crisps properly.

  9. 9

    Stir the soy sauce into the warm broth in the small pot, tasting and adding 1 teaspoon more soy sauce if it tastes too mild — it should taste savory and salty.

  10. 10

    Divide the cooked soba noodles between two bowls, pouring half the hot dashi broth into each bowl.

  11. 11

    Arrange 6 pieces of crispy tempura shrimp on top of each bowl and serve immediately while the shrimp are still warm and crunchy.

Tools you’ll need

  • medium heavy-bottomed pot or deep skillet (at least 6 inches diameter)
  • small pot
  • large pot for boiling water
  • fine-mesh strainer
  • small bowl
  • fork or chopsticks
  • slotted spoon
  • paper towels
  • two serving bowls
  • candy thermometer (optional, to verify oil temperature)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.