CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ebi Tempura Udon

Crispy shrimp tempura served over silky udon noodles in a hot dashi broth. A classic Japanese comfort dish ready in under 30 minutes with minimal ingredients.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Ebi Tempura Udon
comfortsatisfyingjapaneseshrimpcrispytendersilkyweeknight

Ingredients

  • 8 pieces large shrimp, peeled and deveined
  • ½ cup all-purpose flour
  • 2 cups neutral oil, for deep-frying
  • 4 cups dashi stock (or water with 1 tsp dashi powder stirred in)
  • 3 tablespoons soy sauce
  • 10 oz fresh udon noodles

Instructions

  1. 1

    Pat the shrimp dry using paper towels by pressing gently on each one until no moisture remains, so the batter will stick better.

  2. 2

    Pour the flour into a shallow bowl and set it on the counter next to where you will fry.

  3. 3

    Place a plate lined with paper towels near the stove—this is where the cooked tempura will drain.

  4. 4

    Pour the dashi stock into a large pot and set it over medium-high heat; cover with a lid so it heats faster, about 5 minutes.

  5. 5

    Once the broth reaches a simmer (small bubbles breaking the surface steadily), stir in 3 tablespoons of soy sauce until combined.

  6. 6

    Reduce the heat to medium-low and keep the broth at a gentle simmer while you cook the tempura.

  7. 7

    Pour 2 cups of neutral oil into a medium saucepan and set it over medium-high heat; it's ready when a pinch of flour dropped in immediately sizzles and browns in 2–3 seconds, about 4 minutes.

  8. 8

    Coat each shrimp lightly in flour, shaking off any excess, so the batter layer will be thin and crispy.

  9. 9

    Carefully place 4 shrimp into the hot oil, one at a time, spacing them apart; do not overcrowd the pan.

  10. 10

    Fry for 90 seconds until the flour coating turns golden brown (the color of butterscotch), then flip each shrimp using cooking chopsticks or a slotted spoon.

  11. 11

    Fry the second side for another 60 seconds until it matches the first side in color, then lift the shrimp out with a slotted spoon and place on the paper towel–lined plate.

  12. 12

    Repeat steps 9–11 with the remaining 4 shrimp, maintaining the oil temperature so each batch cooks at the same rate.

  13. 13

    Drop the udon noodles into the simmering broth and stir gently with chopsticks or a wooden spoon to separate them; cook for 2 minutes until they heat through.

  14. 14

    Divide the noodles and broth equally between two large bowls, using a slotted spoon for noodles and a ladle for broth.

  15. 15

    Arrange 4 crispy shrimp on top of the noodles in each bowl, centering them in the broth.

Tools you’ll need

  • large pot with lid
  • medium saucepan
  • shallow bowl
  • paper towels and plate
  • slotted spoon
  • cooking chopsticks or wooden spoon
  • ladle
  • thermometer (optional, to verify oil temperature)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.