Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ebi Tempura Udon

Crispy shrimp tempura served over silky udon noodles in a hot dashi broth. A classic Japanese comfort dish ready in under 30 minutes with minimal ingredients.

Total time
28 min
Servings
2
Calories
520
Protein
18g
Ebi Tempura Udon
comfortsatisfyingjapaneseshrimpcrispytendersilkyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry using paper towels by pressing gently on each one until no moisture remains, so the batter will stick better.

  2. Step 2

    Pour the flour into a shallow bowl and set it on the counter next to where you will fry.

  3. Step 3

    Place a plate lined with paper towels near the stove—this is where the cooked tempura will drain.

  4. Step 4

    Pour the dashi stock into a large pot and set it over medium-high heat; cover with a lid so it heats faster, about 5 minutes.

  5. Step 5

    Once the broth reaches a simmer (small bubbles breaking the surface steadily), stir in 3 tablespoons of soy sauce until combined.

  6. Step 6

    Reduce the heat to medium-low and keep the broth at a gentle simmer while you cook the tempura.

  7. Step 7

    Pour 2 cups of neutral oil into a medium saucepan and set it over medium-high heat; it's ready when a pinch of flour dropped in immediately sizzles and browns in 2–3 seconds, about 4 minutes.

  8. Step 8

    Coat each shrimp lightly in flour, shaking off any excess, so the batter layer will be thin and crispy.

  9. Step 9

    Carefully place 4 shrimp into the hot oil, one at a time, spacing them apart; do not overcrowd the pan.

  10. Step 10

    Fry for 90 seconds until the flour coating turns golden brown (the color of butterscotch), then flip each shrimp using cooking chopsticks or a slotted spoon.

  11. Step 11

    Fry the second side for another 60 seconds until it matches the first side in color, then lift the shrimp out with a slotted spoon and place on the paper towel–lined plate.

  12. Step 12

    Repeat steps 9–11 with the remaining 4 shrimp, maintaining the oil temperature so each batch cooks at the same rate.

  13. Step 13

    Drop the udon noodles into the simmering broth and stir gently with chopsticks or a wooden spoon to separate them; cook for 2 minutes until they heat through.

  14. Step 14

    Divide the noodles and broth equally between two large bowls, using a slotted spoon for noodles and a ladle for broth.

  15. Step 15

    Arrange 4 crispy shrimp on top of the noodles in each bowl, centering them in the broth.

Tools you’ll need

  • large pot with lid
  • medium saucepan
  • shallow bowl
  • paper towels and plate
  • slotted spoon
  • cooking chopsticks or wooden spoon
  • ladle
  • thermometer (optional, to verify oil temperature)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.