Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sigara Börek with Cheese & Herb Filling

Crispy fried phyllo pastry rolls filled with salty cheese and fresh herbs—a beloved Turkish appetizer turned main. Golden, crunchy, and ready in under an hour.

Total time
45 min
Servings
4
Calories
520
Protein
14g
Sigara Börek with Cheese & Herb Filling
indulgentsatisfyingturkishvegetariancheesecrispycreamydinner

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, parsley, dill, salt, and pepper in a bowl until combined.

  2. Step 2

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. Step 3

    Spread 2 tbsp filling along the bottom edge, leaving a 1-inch border on sides.

  4. Step 4

    Fold sides inward, then roll tightly away from you into a cylinder. Seal seam with beaten egg.

  5. Step 5

    Repeat with remaining phyllo sheets and filling until you have 12 rolls.

  6. Step 6

    Heat oil in a deep skillet or pot over medium-high until a wooden spoon sizzles immediately when dipped.

  7. Step 7

    Carefully slide 3–4 rolls into hot oil. Fry until golden brown on all sides, ~4 minutes total.

  8. Step 8

    Remove with a slotted spoon and drain on paper towels. Repeat with remaining rolls.

  9. Step 9

    Serve hot while crispy. Pair with yogurt or a squeeze of fresh lemon if desired.

Tools you’ll need

  • cutting board
  • medium mixing bowl
  • pastry brush
  • deep skillet or Dutch oven
  • slotted spoon
  • paper towels
  • meat thermometer (optional, for oil temp check)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.