Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Simple Sushi Platter

A fresh, no-cook sushi spread featuring seasoned rice, raw salmon, cucumber, and avocado arranged on a board. Perfect for a quick Japanese-inspired meal or light dinner.

Total time
25 min
Servings
2
Calories
380
Protein
28g
Simple Sushi Platter
lightfreshjapanesefishtendercreamycrispweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 2 tablespoons of rice vinegar over the 2 cups of cooled sushi rice in a large bowl and stir gently with a wooden spoon until the vinegar is evenly distributed and the rice looks slightly glossy, about 1 minute.

  2. Step 2

    Pat the 8 ounces of salmon dry with a clean paper towel, then place it on a cutting board and slice it into 1/4-inch-thick rectangles by cutting straight down through the width of the fillet.

  3. Step 3

    Place the cucumber on a cutting board and slice it lengthwise into thin 1/8-inch-thick sticks by laying it on its side and slicing along its length, like cutting a carrot into matchsticks.

  4. Step 4

    Cut the avocado in half lengthwise around the pit, twist the halves apart, remove the pit with a spoon, then scoop the flesh out of each half with a spoon and slice it into 1/4-inch-thick slices.

  5. Step 5

    Spread the seasoned rice across a large wooden or ceramic board or serving platter in a 1/2-inch-thick even layer, creating a rectangular bed about 10 by 6 inches.

  6. Step 6

    Arrange the salmon slices in a single layer covering the left third of the rice, slightly overlapping each slice.

  7. Step 7

    Arrange the cucumber sticks in a neat bundle in the center third of the rice, standing them upright or laying them parallel to one another.

  8. Step 8

    Arrange the avocado slices in the right third of the rice, overlapping them slightly to cover the area.

  9. Step 9

    Pour 3 tablespoons of soy sauce into a small shallow bowl and place it at one corner of the board for dipping.

Tools you’ll need

  • large bowl
  • wooden spoon
  • cutting board
  • chef's knife
  • paper towels
  • spoon
  • large wooden or ceramic serving board
  • small shallow bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.