Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

California Roll at Home

Crispy-outside, creamy-inside sushi rolls made with imitation crab, avocado, and cucumber—no special equipment needed. Perfect for a fun dinner or entertaining.

Total time
25 min
Servings
2
Calories
310
Protein
8g
California Roll at Home
freshcasualjapanesecrispycreamyweeknightdate-nightsushi

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine warm cooked sushi rice and rice vinegar in a bowl. Stir gently to coat.

  2. Step 2

    Slice avocado and cucumber into thin lengthwise strips.

  3. Step 3

    Place one nori sheet shiny-side down on a bamboo mat. Spread half the rice in a thin layer, leaving a 0.5-inch border at the top.

  4. Step 4

    Arrange half the crab, avocado, and cucumber in a horizontal line across the center of the rice.

  5. Step 5

    Roll tightly away from you, using the mat to guide it. Seal the edge with a dab of water.

  6. Step 6

    Repeat with remaining nori sheet and fillings. Slice each roll into 6-8 pieces with a sharp, wet knife.

  7. Step 7

    Serve with soy sauce on the side.

Tools you’ll need

  • bowl
  • bamboo sushi mat
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.