CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Skillet Apple Cobbler

Tender cinnamon apples with a warm buttery crumble topping, ready in 15 minutes. No rolling, no fuss — just slice, toss, and bake.

Total time
15 min
Servings
4
Calories
285
Protein
2g
15-Min Skillet Apple Cobbler
comfortcozyamericanvegetariancrispytenderweeknightcozy

Ingredients

  • 5 medium apples, peeled and sliced
  • ½ cup sugar, divided
  • ¾ cup flour
  • 4 tbsp butter, cold and cubed

Instructions

  1. 1

    Toss apple slices with half the sugar in a 10-inch cast iron skillet.

  2. 2

    Mix flour with remaining sugar, then pinch in cold butter until mix looks sandy.

  3. 3

    Sprinkle flour crumble over apples, covering the surface evenly.

  4. 4

    Bake at 400°F for 12 minutes until topping is golden and apples bubble at edges.

  5. 5

    Cool 2 minutes, then serve warm in bowls.

Tools you’ll need

  • 10-inch cast iron skillet or 9x9-inch baking dish
  • oven
  • mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.