Back to recipes
15-Min Skillet Apple Cobbler
Tender cinnamon apples with a warm buttery crumble topping, ready in 15 minutes. No rolling, no fuss — just slice, toss, and bake.
- Total time
- 15 min
- Servings
- 4
- Calories
- 285
- Protein
- 2g
comfortcozyamericanvegetariancrispytenderweeknightcozy
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Toss apple slices with half the sugar in a 10-inch cast iron skillet.
Step 2
Mix flour with remaining sugar, then pinch in cold butter until mix looks sandy.
Step 3
Sprinkle flour crumble over apples, covering the surface evenly.
Step 4
Bake at 400°F for 12 minutes until topping is golden and apples bubble at edges.
Step 5
Cool 2 minutes, then serve warm in bowls.
Tools you’ll need
- 10-inch cast iron skillet or 9x9-inch baking dish
- oven
- mixing bowl
- spoon
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
