Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Skillet Chocolate Chip Cookie

Warm, gooey cookie baked in a cast iron skillet and served straight from the pan with vanilla ice cream. Crispy edges, chewy center, ready in under 20 minutes.

Total time
18 min
Servings
4
Calories
520
Protein
6g
Skillet Chocolate Chip Cookie
indulgentcozyamericanvegetariancrispychewygooeyDessert

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 350°F. Mix softened butter, brown sugar, and granulated sugar in a bowl until creamy.

  2. Step 2

    Stir in egg and vanilla extract until fully combined.

  3. Step 3

    Fold in flour with a pinch of salt until no dry streaks remain, then fold in chocolate chips.

  4. Step 4

    Pour dough into a buttered 10-inch cast iron skillet, spreading evenly to the edges.

  5. Step 5

    Bake for 12-14 minutes until edges are golden brown but center still looks slightly underdone.

  6. Step 6

    Top with a scoop of vanilla ice cream and serve straight from the skillet while warm.

Tools you’ll need

  • 10-inch cast iron skillet
  • mixing bowl
  • spatula or wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.