Crispy Bacon Pierogi
Frozen pierogi crisped in a skillet with bacon until golden, served with sour cream. Dinner on the table in 15 minutes.
- Total time
- 15 min
- Servings
- 2
- Calories
- 520
- Protein
- 18g

comfortquickpolishporkcrispytenderweeknightmain-dish
Ingredients
- 6 slices bacon
- 1 lb frozen pierogi
- ½ cup sour cream
Instructions
- 1
Cook bacon in a large skillet over medium-high heat until crispy, about 8 minutes.
- 2
Transfer bacon to a plate; chop into bite-size pieces.
- 3
Add frozen pierogi to the bacon fat and sear without stirring for 3 minutes until bottoms turn golden.
- 4
Stir and cook 2 more minutes until pierogi are heated through and edges crisp.
- 5
Toss in the chopped bacon and transfer to a plate.
- 6
Serve with a dollop of sour cream on the side.
Tools you’ll need
- 12-inch skillet
- wooden spoon
- plate
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



