Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Bacon Pierogi

Frozen pierogi crisped in a skillet with bacon until golden, served with sour cream. Dinner on the table in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Crispy Bacon Pierogi
comfortquickpolishporkcrispytenderweeknightmain-dish

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook bacon in a large skillet over medium-high heat until crispy, about 8 minutes.

  2. Step 2

    Transfer bacon to a plate; chop into bite-size pieces.

  3. Step 3

    Add frozen pierogi to the bacon fat and sear without stirring for 3 minutes until bottoms turn golden.

  4. Step 4

    Stir and cook 2 more minutes until pierogi are heated through and edges crisp.

  5. Step 5

    Toss in the chopped bacon and transfer to a plate.

  6. Step 6

    Serve with a dollop of sour cream on the side.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.