Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Berry Strudel with Fresh Berries

Flaky phyllo layers stuffed with mixed berries and a touch of cinnamon, baked until golden. Top with fresh strawberries and tart red currants for a dessert-dinner that looks showstopping but comes together in under 25 minutes.

Total time
25 min
Servings
4
Calories
245
Protein
3g
Crispy Berry Strudel with Fresh Berries
elegantindulgentaustrianvegetariancrispyflakytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Line a sheet pan with parchment paper.

  2. Step 2

    Toss mixed berries with sugar and cinnamon in a small bowl until coated.

  3. Step 3

    Lay one phyllo sheet on the pan, brush lightly with melted butter. Repeat with 5 more sheets, brushing each layer.

  4. Step 4

    Spread mixed berries in a line down the center of the phyllo stack, leaving 2 inches on all sides.

  5. Step 5

    Fold the two long sides of phyllo over the filling, then fold in the short sides to form a sealed packet. Brush exterior with remaining butter.

  6. Step 6

    Bake until golden brown and crispy, 12–14 minutes. Remove from oven and dust with powdered sugar.

  7. Step 7

    Top with fresh strawberries and red currants. Serve warm while phyllo is still crispy.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small mixing bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.