CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Berry Strudel with Fresh Berries

Flaky phyllo layers stuffed with mixed berries and a touch of cinnamon, baked until golden. Top with fresh strawberries and tart red currants for a dessert-dinner that looks showstopping but comes together in under 25 minutes.

Total time
25 min
Servings
4
Calories
245
Protein
3g
Crispy Berry Strudel with Fresh Berries
elegantindulgentaustrianvegetariancrispyflakytenderweeknight

Ingredients

  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 1.5 cups mixed berries (blueberries, raspberries, blackberries)
  • 3 tbsp granulated sugar
  • ¼ tsp ground cinnamon
  • 1 cup fresh strawberries, halved
  • ½ cup red currants
  • 2 tbsp powdered sugar for dusting

Instructions

  1. 1

    Preheat oven to 375°F. Line a sheet pan with parchment paper.

  2. 2

    Toss mixed berries with sugar and cinnamon in a small bowl until coated.

  3. 3

    Lay one phyllo sheet on the pan, brush lightly with melted butter. Repeat with 5 more sheets, brushing each layer.

  4. 4

    Spread mixed berries in a line down the center of the phyllo stack, leaving 2 inches on all sides.

  5. 5

    Fold the two long sides of phyllo over the filling, then fold in the short sides to form a sealed packet. Brush exterior with remaining butter.

  6. 6

    Bake until golden brown and crispy, 12–14 minutes. Remove from oven and dust with powdered sugar.

  7. 7

    Top with fresh strawberries and red currants. Serve warm while phyllo is still crispy.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small mixing bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.