Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spiced Lentil & Potato Fatira

A crispy, stuffed Ethiopian pastry filled with savory lentils and potatoes, spiked with berbere spice and cooked in a skillet until golden. Ready in under 30 minutes with store-bought pastry.

Total time
28 min
Servings
4
Calories
485
Protein
14g
Spiced Lentil & Potato Fatira
comfortrusticethiopianvegetarianveganlentilscrispyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium. Add onion and ginger; cook 2 minutes until fragrant.

  2. Step 2

    Stir in potatoes, cooked lentils, berbere, salt, and broth. Simmer 8 minutes until potatoes soften, stirring occasionally.

  3. Step 3

    Spread filling on one half of each pastry sheet, leaving a 0.5-inch border. Fold pastry in half; press edges to seal.

  4. Step 4

    Wipe skillet clean. Heat 3 tbsp oil over medium-high until shimmering.

  5. Step 5

    Slide fatiras into skillet. Pan-fry 4 minutes per side until deep golden brown and crispy.

  6. Step 6

    Transfer to a plate. Cool 1 minute, then cut in half. Serve hot with lemon wedges if desired.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.