Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Beef-Stuffed Peppers

Roasted rocoto peppers stuffed with seasoned ground beef, topped with melted cheese and a bright cream sauce. Ready in 25 minutes—the TikTok version of Peru's iconic rocoto relleno.

Total time
25 min
Servings
2
Calories
385
Protein
28g
Spicy Beef-Stuffed Peppers
comfortboldperuvianbeeftendercreamyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the tops off peppers and scoop out seeds. Arrange peppers cut-side up on a sheet pan.

  2. Step 2

    Heat a skillet over medium-high. Cook ground beef with diced onion, breaking up the meat, until no pink remains, about 5 minutes.

  3. Step 3

    Stir in half the queso fresco and 1 tbsp vinegar. Season with salt and pepper to taste.

  4. Step 4

    Divide the beef mixture between the pepper halves. Sprinkle remaining cheese on top. Bake at 400°F until peppers are tender and edges char, 10 minutes.

  5. Step 5

    Whisk sour cream with 1 tbsp water and a pinch of salt until pourable. Drizzle over hot peppers and garnish with cilantro.

Tools you’ll need

  • sharp knife
  • sheet pan
  • 12-inch skillet
  • wooden spoon
  • small whisk or fork
  • oven (preheated to 400°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.