Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Bibim Kalguksu

Hand-torn noodles in a gochujang-spiked broth, tossed with crispy fried vegetables and a runny egg. One bowl, 25 minutes, pure comfort.

Total time
25 min
Servings
2
Calories
480
Protein
16g
Spicy Bibim Kalguksu
comfortcozykoreanvegetarianeggschewycrispysilky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 cup water and a pinch of salt until shaggy. Knead 2 minutes until smooth, then let rest 5 minutes.

  2. Step 2

    Slice zucchini, carrot, and mushrooms into thin matchsticks. Heat 1 tbsp sesame oil in a skillet over medium-high.

  3. Step 3

    Fry vegetables in batches until edges curl and brown slightly, ~3 minutes total. Transfer to a plate, sprinkle with salt.

  4. Step 4

    Bring broth to a boil in a large pot. Tear dough into bite-sized pieces and drop them in, stirring gently until they float.

  5. Step 5

    Stir in gochujang until dissolved. Slide 2 eggs into the simmering broth and cook until whites set, ~2 minutes.

  6. Step 6

    Divide noodles and broth between bowls, top with fried vegetables, drizzle remaining sesame oil, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • 12-inch skillet
  • large pot (4-quart or bigger)
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.