Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Chicken Wings

Crispy baked chicken wings tossed in a fiery, garlicky red sauce with fresh herbs. Perfect for game day or a weeknight dinner.

Total time
50 min
Servings
4
Calories
450
Protein
30g
Spicy Chicken Wings
comfort foodpartyAmericangluten-freechickencrispytendergame day

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat the 2 lb chicken wings dry with paper towels, then toss with 2 tbsp vegetable oil, 1 tsp salt, and 1/2 tsp black pepper in a large bowl.

  2. Step 2

    Arrange wings in a single layer on a baking sheet lined with foil. Bake for 40-45 minutes, flipping halfway, until golden brown and crispy, with internal temperature reaching 165°F.

  3. Step 3

    While wings bake, melt 2 tbsp butter in a small saucepan over medium heat. Add 3 minced garlic cloves and cook until fragrant, about 1 minute.

  4. Step 4

    Stir 1/2 cup hot sauce into the butter mixture and simmer for 2-3 minutes until slightly thickened. Remove from heat.

  5. Step 5

    Transfer baked wings to a large bowl, pour the sauce over, and toss to coat evenly. Sprinkle with 1/4 cup chopped fresh parsley and serve hot.

  6. Step 6

    For extra heat, add a pinch of cayenne or red pepper flakes to the sauce. Serve with celery sticks and blue cheese dressing if desired.

Tools you’ll need

  • baking sheet
  • aluminum foil
  • large bowl
  • small saucepan
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.