Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Fish with Lime and Chili

A quick, fiery fish dish with fresh lime, chili, and garlic. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
250
Protein
35g
Spicy Fish with Lime and Chili
comfortingmexicangluten-freedairy-freefishflakyweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb fish fillets dry and season both sides with the 1 tsp salt. Juice 1 lime and slice the other into wedges for serving.

  2. Step 2

    Mince the 4 garlic cloves and finely chop the 2 red chili peppers (remove seeds for less heat).

  3. Step 3

    Heat the 2 tbsp olive oil in a large skillet over medium-high. Add the garlic and chili, cook until fragrant, about 1 minute.

  4. Step 4

    Place the fish in the skillet, skin-side down if applicable. Cook until golden and opaque, about 3-4 minutes per side, depending on thickness.

  5. Step 5

    Squeeze the lime juice over the fish, cook 1 minute more. Serve hot with lime wedges and extra chili if desired.

Tools you’ll need

  • large skillet
  • knife
  • cutting board
  • citrus juicer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.