Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Grilled Beef Intestines (Gopchang)

Tender beef intestines marinated in gochujang and soy, grilled until crispy at the edges. A bold, savory Korean classic that's surprisingly approachable at home.

Total time
28 min
Servings
2
Calories
280
Protein
32g
Spicy Grilled Beef Intestines (Gopchang)
boldcasualkoreanbeeftendercrispyweeknightdate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir gochujang, soy sauce, sesame oil, garlic, and sugar in a large bowl until smooth.

  2. Step 2

    Add the cleaned intestines and toss to coat evenly. Let sit for 5 minutes.

  3. Step 3

    Heat a cast iron skillet or grill pan over medium-high until shimmering, about 1 minute.

  4. Step 4

    Working in batches, cook the intestines 3–4 minutes per side without stirring. Edges should char and crisp.

  5. Step 5

    Transfer cooked intestines to a serving plate. Scatter scallions on top.

  6. Step 6

    Serve immediately with rice and kimchi on the side.

Tools you’ll need

  • large mixing bowl
  • 12-inch cast iron skillet or grill pan
  • tongs
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.