Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Mee Goreng with Crispy Chicken & Satay

A complete Malaysian street-food dinner: crispy fried noodles tossed in spicy-sweet sauce, topped with pan-seared chicken, shrimp crackers, fresh cucumber, and a side of peanut satay. Packed with heat, texture, and big flavor in under 30 minutes.

Total time
28 min
Servings
2
Calories
580
Protein
32g
Spicy Mee Goreng with Crispy Chicken & Satay
boldsatisfyingmalaysianchickenshrimpcrispytendercrunchy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil egg noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering. Season chicken with salt and pepper.

  3. Step 3

    Sear chicken 3 minutes per side without stirring until golden and cooked through. Transfer to a plate.

  4. Step 4

    In the same skillet, add cooked noodles. Stir in gochujang, ketchup, lime juice, and 2 tbsp water until noodles are evenly coated and glossy.

  5. Step 5

    Return chicken to the skillet and toss to combine. Cook 1 minute until heated through.

  6. Step 6

    Divide noodles between plates. Top with shrimp crackers and cucumber slices. Serve satay dip (mix peanut butter with 1 tbsp water and a pinch of salt) on the side.

Tools you’ll need

  • large skillet (12-inch)
  • pot (for boiling noodles)
  • colander
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.