Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Malaysian Mee Goreng with Chicken & Satay

Crispy fried noodles tossed with spicy sweet-sour sauce, topped with seared chicken, satay skewers, shrimp crackers, and fresh cucumber. Complete one-pan dinner ready in 25 minutes.

Total time
25 min
Servings
2
Calories
612
Protein
38g
Malaysian Mee Goreng with Chicken & Satay
casualsatisfyingmalaysianchickenshrimpcrispytendercrunchy

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until al dente, drain, and set aside.

  2. Step 2

    Slice cucumber into thin rounds. Heat 2 tbsp oil in a large skillet over medium-high.

  3. Step 3

    Pat chicken dry, season with salt and pepper. Sear 5–6 minutes per side until golden and cooked through.

  4. Step 4

    Remove chicken and rest 2 minutes, then slice. In the same skillet, add noodles, chili paste, lime juice, oyster sauce, and sugar.

  5. Step 5

    Toss noodles over medium heat until coated and fragrant, 2–3 minutes. Warm satay skewers in the pan alongside.

  6. Step 6

    Divide noodles between bowls. Top with sliced chicken, satay skewers, cucumber, and a handful of shrimp crackers. Serve hot.

Tools you’ll need

  • large pot for boiling noodles
  • 12-inch skillet
  • cutting board and knife
  • tongs or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.