Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Mixed Protein Fried Rice

Nasi goreng mawut—Indonesian fried rice loaded with shrimp, chicken, and egg, bound together with a fiery sambal-soy glaze. Crispy, punchy, done in 25 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Spicy Mixed Protein Fried Rice
satisfyingquickindonesianchickenshrimpcrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large wok or skillet over high heat. Add diced chicken, stirring, until no pink remains, about 4 minutes.

  2. Step 2

    Add shrimp, stirring, until they pink and curl, about 2 minutes. Push everything to the side of the pan.

  3. Step 3

    Pour beaten eggs into the empty space and scramble until just set, about 60 seconds. Fold in with the protein.

  4. Step 4

    Stir in chilled rice, breaking up clumps with the back of a spoon, for 2 minutes until grains separate and heat through.

  5. Step 5

    Add sambal and soy sauce, tossing constantly, until rice is glossy and evenly coated, about 60 seconds.

  6. Step 6

    Transfer to a plate and top with sliced shallots or green onion. Serve hot.

Tools you’ll need

  • large wok or 12-inch skillet
  • wooden spoon
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.