Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Seafood Jjamppong

Korean seafood stew with shrimp, mussels, and squid in a fiery gochujang broth with broccoli and mushrooms. One skillet, 20 minutes, restaurant vibes.

Total time
20 min
Servings
2
Calories
220
Protein
32g
Spicy Seafood Jjamppong
boldindulgentkoreanshrimpfishtenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, ~90 seconds.

  2. Step 2

    Add minced garlic (3 cloves) and gochujang. Stir constantly for 60 seconds until fragrant.

  3. Step 3

    Pour in fish stock. Add mushrooms and broccoli. Bring to a simmer and cook 5 minutes.

  4. Step 4

    Add seafood mix, gochugaru, and soy sauce. Stir gently and simmer 4 minutes until shrimp turns pink.

  5. Step 5

    Taste and adjust seasoning with salt or soy sauce. Ladle into bowls with broth.

Tools you’ll need

  • large skillet (12-inch or bigger)
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.