Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Shrimp Tempura Dynamite Roll

Crispy tempura shrimp and avocado tucked into sushi rice and nori, topped with spicy mayo and a sprinkle of sesame. A weeknight sushi-bar favorite that comes together in under 20 minutes.

Total time
20 min
Servings
2
Calories
480
Protein
18g
Spicy Shrimp Tempura Dynamite Roll
casualindulgentjapaneseshrimpcrispycreamychewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk mayo and sriracha together until bright red. Set aside.

  2. Step 2

    Heat oil in a deep skillet or pot to 350°F (or until a small piece of nori sizzles immediately).

  3. Step 3

    Mix flour and cornstarch with ice water until a loose batter forms. Dip shrimp into batter, coating fully.

  4. Step 4

    Fry battered shrimp 2–3 minutes, turning once, until golden and crispy. Transfer to a paper towel.

  5. Step 5

    Lay nori shiny-side down on a clean surface. Spread a thin layer of rice (about 1/4 inch) across most of the sheet.

  6. Step 6

    Place 4 shrimp and a few avocado slices on the rice near the bottom edge. Roll tightly away from you, sealing with a dab of water.

  7. Step 7

    Slice the roll into 6 pieces with a sharp, wet knife. Drizzle with spicy mayo and serve immediately.

Tools you’ll need

  • deep skillet or pot (3+ quarts)
  • thermometer or wooden chopstick for temperature test
  • paper towels
  • small bowl for mixing mayo-sriracha
  • shallow bowl for batter
  • bamboo sushi mat (optional, helps with rolling)
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.