CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Shrimp Tempura Dynamite Roll

Crispy tempura shrimp and avocado tucked into sushi rice and nori, topped with spicy mayo and a sprinkle of sesame. A weeknight sushi-bar favorite that comes together in under 20 minutes.

Total time
20 min
Servings
2
Calories
480
Protein
18g
Spicy Shrimp Tempura Dynamite Roll
casualindulgentjapaneseshrimpcrispycreamychewyweeknight

Ingredients

  • 1.5 cups cooked sushi rice (or day-old rice, cooled)
  • 2 sheets nori (seaweed sheets)
  • 8 oz shrimp, peeled and patted dry
  • 3 tbsp mayonnaise
  • 1 tbsp sriracha
  • 1 whole avocado, sliced thin
  • ½ cup all-purpose flour mixed with cornstarch (equal parts)
  • ½ cup ice water

Instructions

  1. 1

    Whisk mayo and sriracha together until bright red. Set aside.

  2. 2

    Heat oil in a deep skillet or pot to 350°F (or until a small piece of nori sizzles immediately).

  3. 3

    Mix flour and cornstarch with ice water until a loose batter forms. Dip shrimp into batter, coating fully.

  4. 4

    Fry battered shrimp 2–3 minutes, turning once, until golden and crispy. Transfer to a paper towel.

  5. 5

    Lay nori shiny-side down on a clean surface. Spread a thin layer of rice (about 1/4 inch) across most of the sheet.

  6. 6

    Place 4 shrimp and a few avocado slices on the rice near the bottom edge. Roll tightly away from you, sealing with a dab of water.

  7. 7

    Slice the roll into 6 pieces with a sharp, wet knife. Drizzle with spicy mayo and serve immediately.

Tools you’ll need

  • deep skillet or pot (3+ quarts)
  • thermometer or wooden chopstick for temperature test
  • paper towels
  • small bowl for mixing mayo-sriracha
  • shallow bowl for batter
  • bamboo sushi mat (optional, helps with rolling)
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.