Custrd is out on the App Store — Download it free →
Back to recipes

Stir-Fried Pork with Chili Peppers

A quick and savory stir-fry with tender pork, spicy chili peppers, and crisp green vegetables. Perfect for a weeknight dinner, ready in about 30 minutes.

Total time
30 min
Servings
4
Calories
320
Protein
28g
Stir-Fried Pork with Chili Peppers
comfort foodChinesedairy-freeporktendercrispweeknightstir-fry

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, toss the 1 lb sliced pork with 2 tbsp soy sauce and 1 tbsp cornstarch. Let it marinate for 10 minutes while you prep the vegetables.

  2. Step 2

    Heat 2 tbsp vegetable oil in a wok or large skillet over high heat until shimmering. Add the pork in a single layer and cook without stirring for 1-2 minutes until browned, then stir-fry for 2-3 minutes until just cooked through. Remove to a plate.

  3. Step 3

    Add the remaining 1 tbsp oil to the skillet. Add the 4 sliced chili peppers, 1 sliced green bell pepper, and 3 minced garlic cloves. Stir-fry over high heat for 2-3 minutes until the peppers are slightly charred and fragrant.

  4. Step 4

    Return the pork to the skillet. Add the 4 green onion pieces and the remaining 1 tbsp soy sauce. Stir-fry everything together for 1-2 minutes until the sauce coats the pork and vegetables and everything is hot.

  5. Step 5

    Serve immediately over steamed rice if desired.

Tools you’ll need

  • Wok or large skillet
  • Cutting board
  • Chef's knife
  • Mixing bowl
  • Measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.