Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Strawberry Daifuku Mochi

Soft, pillowy mochi filled with fresh strawberry and sweet red bean paste — a TikTok-viral Japanese dessert you can make at home in under 20 minutes with just a microwave and a few pantry staples.

Total time
18 min
Servings
4
Calories
185
Protein
1g
Strawberry Daifuku Mochi
lightrefreshingjapanesevegetariandairy-freechewysoftgooey

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix mochiko, sugar, and water in a microwave-safe bowl until smooth with no lumps.

  2. Step 2

    Microwave uncovered on high for 2 minutes. Stir well, then microwave 1 more minute until thick and glossy.

  3. Step 3

    Spread cornstarch on a plate. Pour hot mochi onto it and dust the top with more cornstarch. Let cool 5 minutes.

  4. Step 4

    Pat mochi lightly with cornstarch until it's no longer sticky. Divide into 8 pieces.

  5. Step 5

    Flatten each piece into a thin disc. Place 1 tsp bean paste and 1 strawberry in the center of each.

  6. Step 6

    Fold mochi edges up and around the filling, pinching and sealing at the top. Roll gently in palms to smooth.

  7. Step 7

    Serve immediately or refrigerate up to 2 days in an airtight container.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • spoon or spatula
  • dinner plate
  • parchment paper or airtight container

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.