Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sweet Mochi & Crispy Rice Crackers

Chewy homemade mochi with a smooth sweet filling, ready in 15 minutes and served alongside senbei for contrast. No special equipment needed—just a microwave and your hands.

Total time
15 min
Servings
2
Calories
280
Protein
1g
Sweet Mochi & Crispy Rice Crackers
lightfreshjapanesevegetariandairy-freechewysoftsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix mochiko, sugar, and water in a microwave-safe bowl until smooth and no lumps remain.

  2. Step 2

    Microwave uncovered for 2 minutes, stir well, then microwave 1 more minute until thick and glossy.

  3. Step 3

    Dust a clean surface generously with cornstarch to prevent sticking.

  4. Step 4

    Transfer hot mochi to the cornstarch, cool for 1 minute, then knead gently until smooth.

  5. Step 5

    Divide mochi into 4–6 pieces, flatten each into a thin disc, add 1 tbsp filling in the center.

  6. Step 6

    Fold and seal the edges, dust with more cornstarch, and serve alongside senbei crackers.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • spoon for stirring
  • cutting board or parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.