CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sweet Mochi & Crispy Rice Crackers

Chewy homemade mochi with a smooth sweet filling, ready in 15 minutes and served alongside senbei for contrast. No special equipment needed—just a microwave and your hands.

Total time
15 min
Servings
2
Calories
280
Protein
1g
Sweet Mochi & Crispy Rice Crackers
lightfreshjapanesevegetariandairy-freechewysoftsnack

Ingredients

  • ½ cup sweet white miso or sweetened red bean paste
  • 1 cup mochiko (sweet rice flour)
  • ½ cup granulated sugar
  • ½ cup cornstarch or potato starch
  • ¾ cup water
  • 1 package senbei (Japanese rice crackers)

Instructions

  1. 1

    Mix mochiko, sugar, and water in a microwave-safe bowl until smooth and no lumps remain.

  2. 2

    Microwave uncovered for 2 minutes, stir well, then microwave 1 more minute until thick and glossy.

  3. 3

    Dust a clean surface generously with cornstarch to prevent sticking.

  4. 4

    Transfer hot mochi to the cornstarch, cool for 1 minute, then knead gently until smooth.

  5. 5

    Divide mochi into 4–6 pieces, flatten each into a thin disc, add 1 tbsp filling in the center.

  6. 6

    Fold and seal the edges, dust with more cornstarch, and serve alongside senbei crackers.

Tools you’ll need

  • microwave-safe bowl
  • microwave
  • spoon for stirring
  • cutting board or parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.