Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Strawberry Shortcake Waffles

Fluffy waffles topped with whipped cream and fresh strawberries — the classic breakfast dessert that feels indulgent but takes under 20 minutes. Golden, crispy outside, tender inside.

Total time
20 min
Servings
2
Calories
520
Protein
10g
Strawberry Shortcake Waffles
indulgentcelebratoryamericanvegetarianvegetariancrispyfluffycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, baking powder, and a pinch of salt together in a large bowl.

  2. Step 2

    In another bowl, beat eggs with milk and melted butter until combined.

  3. Step 3

    Pour wet mixture into dry ingredients and stir until just combined — small lumps are okay.

  4. Step 4

    Heat waffle iron and lightly butter it. Pour batter and cook until golden and crispy, ~3–4 minutes.

  5. Step 5

    Whip heavy cream with 1 tbsp sugar and a pinch of vanilla until soft peaks form, ~2 minutes.

  6. Step 6

    Slice strawberries and pile them on warm waffles with whipped cream. Serve immediately.

Tools you’ll need

  • waffle iron
  • large mixing bowl
  • medium mixing bowl
  • whisk
  • measuring cups and spoons
  • knife (for slicing strawberries)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.