Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Korean Chicken Wings

Crispy chicken wings tossed in a sweet-spicy gochujang glaze, topped with sesame seeds and served with pickled red onions and a cool herby dipping sauce. Ready in about 20 minutes for a quick weeknight treat.

Total time
30 min
Servings
4
Calories
450
Protein
30g
Spicy Korean Chicken Wings
comfortingfestivekoreangluten-freechickencrispystickygame day

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat 2 lb chicken wings dry and place on a baking sheet lined with foil. Season with salt and pepper.

  2. Step 2

    Bake wings for 20-25 minutes until golden and crispy, turning once halfway. While they bake, thinly slice 1 red onion and toss with a pinch of salt and a splash of vinegar (if you have it).

  3. Step 3

    In a small bowl, mix 3 tbsp gochujang, 2 tbsp honey, and 1 tbsp water to make a glaze. In another bowl, stir 1/2 cup yogurt with a pinch of salt and pepper for the dipping sauce.

  4. Step 4

    When wings are done, toss them in the glaze until fully coated. Sprinkle with 1 tbsp sesame seeds.

  5. Step 5

    Serve wings with pickled onions and yogurt sauce on the side. Garnish with cilantro or parsley if you have some.

Tools you’ll need

  • baking sheet
  • aluminum foil
  • small bowls
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.