Custrd is out on the App Store — Download it free →
Back to recipes

20-Min Taco Stuffed Peppers

Halved bell peppers stuffed with seasoned ground beef and melted cheddar, baked until tender. Ready in 20 minutes — the weeknight dinner that feels like you tried.

Total time
20 min
Servings
4
Calories
315
Protein
26g
20-Min Taco Stuffed Peppers
comfortamericanbeeftendermeltyweeknightmain-dishdinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the peppers lengthwise, remove seeds and stems, and arrange cut-side up in a baking dish.

  2. Step 2

    Brown the ground beef in a skillet over medium-high heat, breaking it up with a spoon, ~5 minutes.

  3. Step 3

    Stir the taco seasoning and 1/4 cup water into the beef, then simmer 2 minutes until fragrant.

  4. Step 4

    Divide the beef mixture among the pepper halves and top each with a pinch of cheddar cheese.

  5. Step 5

    Bake at 400°F for 10 minutes until peppers soften and cheese melts.

Tools you’ll need

  • 8x8-inch baking dish
  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.