Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tahini Buddha Bowl

Warm quinoa base topped with roasted chickpeas, cucumber, and cherry tomatoes, finished with a creamy tahini-lemon sauce. Ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
14g
Tahini Buddha Bowl
wholesomelightmediterraneanvegetarianveganchickpeascreamycrunchy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse quinoa. Bring 2 cups water to a boil, add quinoa, cover, reduce heat to low.

  2. Step 2

    Pat chickpeas dry. Toss with 1 tbsp olive oil, 0.5 tsp salt, and 0.25 tsp pepper.

  3. Step 3

    Spread chickpeas on a small sheet pan. Roast at 400°F until edges crisp, ~12 minutes.

  4. Step 4

    Whisk tahini with lemon juice, 2 tbsp water, 1 minced garlic clove, 0.25 tsp salt until smooth.

  5. Step 5

    Halve tomatoes. Slice cucumber into half-moons.

  6. Step 6

    Fluff cooked quinoa. Divide between bowls. Top with chickpeas, tomatoes, cucumber, and drizzle with tahini sauce.

Tools you’ll need

  • small saucepan with lid
  • small sheet pan
  • cutting board
  • chef's knife
  • whisk
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.