Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tahini Chickpea Buddha Bowl

Warm roasted chickpeas and broccoli tossed with creamy tahini sauce over a bed of fresh greens. A complete Mediterranean dinner ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Tahini Chickpea Buddha Bowl
freshwholesomemediterraneanvegetarianveganchickpeascrispycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss chickpeas and broccoli with 1 tbsp olive oil, salt, and pepper on a sheet pan.

  2. Step 2

    Roast at 425°F until chickpeas are golden and broccoli edges curl, about 12 minutes.

  3. Step 3

    While roasting, whisk tahini with lemon juice, minced garlic, 2 tbsp water, salt, and pepper until smooth.

  4. Step 4

    Divide greens between two bowls and drizzle with half the tahini sauce.

  5. Step 5

    Top with roasted chickpeas and broccoli, remaining sauce, pomegranate seeds, and lemon zest.

  6. Step 6

    Serve immediately while chickpeas are still warm.

Tools you’ll need

  • sheet pan
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.