CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tahini Chickpea Buddha Bowl

Warm roasted chickpeas and broccoli tossed with creamy tahini sauce over a bed of fresh greens. A complete Mediterranean dinner ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Tahini Chickpea Buddha Bowl
freshwholesomemediterraneanvegetarianveganchickpeascrispycreamy

Ingredients

  • 1 can (15 oz) canned chickpeas, drained and patted dry
  • 3 cups broccoli florets, bite-sized
  • 3 tbsp tahini
  • 1 whole lemon (juiced + zested)
  • 2 cloves garlic cloves, minced
  • 2 cups mixed greens or arugula
  • ½ cup pomegranate seeds or cherry tomatoes, halved

Instructions

  1. 1

    Toss chickpeas and broccoli with 1 tbsp olive oil, salt, and pepper on a sheet pan.

  2. 2

    Roast at 425°F until chickpeas are golden and broccoli edges curl, about 12 minutes.

  3. 3

    While roasting, whisk tahini with lemon juice, minced garlic, 2 tbsp water, salt, and pepper until smooth.

  4. 4

    Divide greens between two bowls and drizzle with half the tahini sauce.

  5. 5

    Top with roasted chickpeas and broccoli, remaining sauce, pomegranate seeds, and lemon zest.

  6. 6

    Serve immediately while chickpeas are still warm.

Tools you’ll need

  • sheet pan
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.