Custrd is out on the App Store — Download it free →
Back to recipes

Teriyaki Chicken with Broccoli and Rice

A quick weeknight stir-fry with juicy chicken, crisp broccoli, and a sweet-savory teriyaki glaze served over steamed rice.

Total time
30 min
Servings
4
Calories
480
Protein
38g
Teriyaki Chicken with Broccoli and Rice
comfortingJapanesedairy-freechickentendercrispweeknightmain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small bowl, whisk the 1/2 cup soy sauce, 1/4 cup brown sugar, 2 tbsp cornstarch, and 1/4 cup water until smooth. Set aside.

  2. Step 2

    Cut the 1.5 lb chicken breast into bite-size pieces. Heat 1 tbsp of the vegetable oil in a large skillet over medium-high heat.

  3. Step 3

    Add the chicken in a single layer and cook without stirring until browned on one side, about 3 minutes. Flip and cook until no longer pink, about 4 more minutes. Transfer to a plate.

  4. Step 4

    Add the remaining 1 tbsp oil and the broccoli florets to the skillet. Stir-fry until bright green and crisp-tender, about 4 minutes.

  5. Step 5

    Return the chicken to the skillet. Pour in the sauce and stir constantly until it thickens and coats everything, about 2 minutes.

  6. Step 6

    Serve the teriyaki chicken and broccoli over the 3 cups cooked rice. Add a sprinkle of sesame seeds or sliced green onion if you have them.

Tools you’ll need

  • large skillet
  • small bowl
  • whisk
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.