Back to recipes
Tlayuda
A crispy Oaxacan-style tortilla topped with refried beans, roasted meat, and shredded cheese, perfect for a hearty meal.
- Total time
- 20 min
- Servings
- 1
- Calories
- 650
- Protein
- 35g
comfortingheartyMexicanbeefchickencrispymeltyweeknight dinner
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oil in a skillet over medium heat and crisp the tortilla on both sides until golden.
Step 2
Spread refried beans evenly over the tortilla, leaving a small border.
Step 3
Top with shredded cheese and roasted meat pieces.
Step 4
Cook for 2-3 minutes until cheese melts and edges are crispy.
Step 5
Season with salt, slice, and serve hot.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
