Back to recipes
Tlayuda
A crispy Oaxacan-style tortilla topped with refried beans, roasted meat, and shredded cheese, perfect for a hearty meal.
- Total time
- 20 min
- Servings
- 1
- Calories
- 650
- Protein
- 35g
comfortingheartyMexicanbeefchickencrispymeltyweeknight dinner
Ingredients
6 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oil in a skillet over medium heat and crisp the tortilla on both sides until golden.
Step 2
Spread refried beans evenly over the tortilla, leaving a small border.
Step 3
Top with shredded cheese and roasted meat pieces.
Step 4
Cook for 2-3 minutes until cheese melts and edges are crispy.
Step 5
Season with salt, slice, and serve hot.
Tools you’ll need
- skillet
- spatula
- knife
- cutting board
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
