Custrd is out on the App Store — Download it free →
Back to recipes

Toasted Sesame Beef with Chinese Toon

A quick stir-fry of tender beef and fragrant Chinese toon, finished with toasted sesame for a nutty, savory weeknight dinner.

Total time
30 min
Servings
4
Calories
350
Protein
28g
Toasted Sesame Beef with Chinese Toon
comfortingChinesedairy-freebeeftendercrispweeknightstir-fry

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, toss the 1 lb beef slices with 2 tbsp soy sauce and 1 tbsp cornstarch. Let marinate for 10 minutes.

  2. Step 2

    Heat 2 tbsp vegetable oil in a wok or large skillet over high heat until shimmering. Add the beef in a single layer and sear until browned, about 2-3 minutes per side. Remove and set aside.

  3. Step 3

    Reduce heat to medium. Add the 3 minced garlic cloves and stir-fry until fragrant, about 30 seconds.

  4. Step 4

    Add the 2 cups Chinese toon leaves and stir-fry until wilted, about 1-2 minutes.

  5. Step 5

    Return the beef to the pan. Add the remaining 1 tbsp soy sauce and 2 tbsp toasted sesame oil. Toss everything together for 1 minute.

  6. Step 6

    Sprinkle with 1 tbsp sesame seeds and serve hot.

Tools you’ll need

  • Wok or large skillet
  • Cutting board
  • Knife
  • Mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.