Custrd is out on the App Store — Download it free →
Back to recipes

Beef and Bell Pepper Stir-Fry

A quick and savory stir-fry with tender beef, colorful bell peppers, and eggplant in a glossy soy sauce glaze. Perfect for a weeknight dinner.

Total time
35 min
Servings
4
Calories
350
Protein
28g
Beef and Bell Pepper Stir-Fry
comfortingChinesedairy-freebeeftendercrispweeknightstir-fry

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, toss the 1 lb beef slices with 1 tbsp soy sauce and 1 tbsp cornstarch. Let marinate for 10 minutes.

  2. Step 2

    Heat 2 tbsp vegetable oil in a large skillet or wok over high heat. Add the beef in a single layer and sear until browned, about 2-3 minutes per side. Remove and set aside.

  3. Step 3

    Add the remaining 1 tbsp oil to the skillet. Add the 1 sliced onion and 2 minced garlic cloves, stir-fry until fragrant, about 1 minute.

  4. Step 4

    Add the 1 cubed eggplant and 2 sliced bell peppers. Stir-fry until the vegetables are tender-crisp, about 5-7 minutes.

  5. Step 5

    Return the beef to the skillet. Add the remaining 2 tbsp soy sauce and stir-fry everything together for 1-2 minutes until the sauce coats the ingredients and the beef is heated through.

  6. Step 6

    Serve hot over rice or noodles.

Tools you’ll need

  • Large skillet or wok
  • Cutting board
  • Knife
  • Mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.