Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Trofie con Fagiolini e Patate

Creamy, rustic pasta with tender green beans and potatoes finished with garlic and olive oil. A humble Sicilian classic that's ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
16g
Trofie con Fagiolini e Patate
comfortrusticitalianvegetarianvegetariantendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1/2-inch cubes. Cut green beans into 2-inch pieces.

  2. Step 2

    Bring a large pot of salted water to a boil. Add potatoes and cook 6 minutes.

  3. Step 3

    Add green beans and pasta to the pot. Stir and boil until pasta is al dente, ~9 minutes.

  4. Step 4

    While pasta cooks, heat olive oil in a small pan over medium. Add garlic and sauté until fragrant, ~2 minutes.

  5. Step 5

    Drain pasta, potatoes, and beans, reserving 1 cup pasta water.

  6. Step 6

    Pour garlic oil over pasta. Add 0.5 cup pasta water and toss gently until silky, adding more water if dry.

  7. Step 7

    Season with salt and pepper. Serve hot.

Tools you’ll need

  • large pot
  • small saucepan
  • cutting board
  • knife
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.