Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pizzoccheri della Valtellina

A rustic Lombard pasta and vegetable dish made with buckwheat noodles, potato, cabbage, and finished with crispy sage butter. Hearty, comforting, and ready in under 50 minutes.

Total time
45 min
Servings
4
Calories
720
Protein
24g
Pizzoccheri della Valtellina
comfortrusticitalianvegetarianvegetariantendercreamyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 0.5-inch cubes. Chop cabbage into 1-inch pieces. Mince garlic.

  2. Step 2

    Bring a large pot of salted water to a boil over high heat.

  3. Step 3

    Add potatoes to boiling water. Cook 5 minutes until just tender, then add pasta.

  4. Step 4

    After pasta cooks 3 minutes, add cabbage to the same pot.

  5. Step 5

    Cook together until pasta is tender and vegetables are soft, ~8 minutes more.

  6. Step 6

    Drain pasta and vegetables, reserving 1 cup of cooking liquid.

  7. Step 7

    Melt 4 tbsp butter in a large skillet over medium heat. Add garlic and sage.

  8. Step 8

    Cook until garlic is golden and sage is fragrant, about 2 minutes.

  9. Step 9

    Add drained pasta and vegetables. Toss gently until coated, ~1 minute.

  10. Step 10

    Pour milk over the pasta. Add cheese cubes and remaining 2 tbsp butter.

  11. Step 11

    Fold gently until cheese melts and sauce coats everything, ~2 minutes.

  12. Step 12

    Season with salt and black pepper. Add reserved cooking liquid if too thick.

  13. Step 13

    Serve immediately while hot.

Tools you’ll need

  • large pot (6-quart)
  • large skillet (12-inch)
  • cutting board
  • chef's knife
  • wooden spoon
  • colander
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.