Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkish Sigara Borek (Cheese & Herb Cigars)

Crispy phyllo pastry rolls filled with crumbled feta, fresh herbs, and aromatics. These savory Turkish breakfast cigars are pan-fried until golden and served hot with yogurt.

Total time
25 min
Servings
2
Calories
285
Protein
9g
Turkish Sigara Borek (Cheese & Herb Cigars)
freshcasualturkishvegetariancheesecrispycreamybrunch

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine feta, parsley, dill, onion, salt, and pepper in a bowl. Mix gently.

  2. Step 2

    Lay one phyllo sheet on a clean surface. Brush lightly with melted butter.

  3. Step 3

    Place 2 tbsp filling on the bottom third of the sheet, leaving 1 inch from edges.

  4. Step 4

    Fold in the left and right edges about 1 inch, then tightly roll the sheet away from you.

  5. Step 5

    Repeat with remaining sheets and filling to make 8 rolls.

  6. Step 6

    Heat 2 tbsp butter in a 10-inch skillet over medium-high heat until shimmering.

  7. Step 7

    Working in batches, pan-fry rolls seam-side down 2–3 minutes until golden brown.

  8. Step 8

    Flip rolls and fry 2 minutes more until the other side is golden. Transfer to a plate.

  9. Step 9

    Serve hot sigara borek with a dollop of yogurt on the side.

Tools you’ll need

  • cutting board
  • small bowl
  • 10-inch skillet
  • pastry brush
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.