Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sigara Borek: Crispy Cheese & Herb Rolls

Golden-fried phyllo rolls stuffed with feta, fresh herbs, and onions—a traditional Turkish breakfast pastry. Crispy, savory, and ready in under 30 minutes.

Total time
25 min
Servings
4
Calories
340
Protein
9g
Sigara Borek: Crispy Cheese & Herb Rolls
freshcasualturkishvegetariancheesecrispyflakyBread

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, diced onion, parsley, dill, and black pepper in a bowl until combined.

  2. Step 2

    Lay one phyllo sheet on a work surface. Cover remaining sheets with a damp towel.

  3. Step 3

    Spoon 2 tbsp filling along the bottom edge of the phyllo sheet, leaving 1 inch from edges.

  4. Step 4

    Fold the left and right edges inward, then roll tightly from bottom to top into a cigar shape.

  5. Step 5

    Repeat with remaining phyllo sheets and filling to make 8 rolls total.

  6. Step 6

    Heat olive oil in a 12-inch skillet over medium-high heat until it shimmers, ~2 minutes.

  7. Step 7

    Working in batches, fry rolls seam-side down 2–3 minutes until golden, then flip and fry 90 seconds more.

  8. Step 8

    Transfer to a paper towel–lined plate. Serve warm with lemon wedges if desired.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • slotted spoon or tongs
  • paper towels
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.