Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spinach & Cheese Sigara Borek

Crispy phyllo cigars filled with spiced spinach and creamy cheese, finished golden and served warm with yogurt. A classic Turkish breakfast that tastes restaurant-quality in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
14g
Spinach & Cheese Sigara Borek
elegantrusticturkishvegetariancheesecrispycreamyflaky

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high. Add diced onion and cook until translucent, 2 minutes.

  2. Step 2

    Add spinach and cook, stirring often, until wilted and any moisture evaporates, 3 minutes.

  3. Step 3

    Transfer spinach to a bowl. Cool 2 minutes, then mix in feta, ricotta, dill, mint, black pepper, and salt.

  4. Step 4

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  5. Step 5

    Spoon 2 tbsp filling along the lower left edge. Fold the left corner over filling, then roll tightly like a cigar.

  6. Step 6

    Repeat with remaining phyllo sheets and filling to make 8 boreks total.

  7. Step 7

    Wipe out the skillet. Heat 2 tbsp oil over medium until shimmering, 90 seconds.

  8. Step 8

    Working in batches, place boreks seam-side down in the skillet. Fry 2 minutes per side until deep golden.

  9. Step 9

    Transfer to a paper towel-lined plate. Serve warm, optionally with Greek yogurt on the side.

Tools you’ll need

  • large skillet (10-inch)
  • cutting board
  • bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.