Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cottage Cheese Strudel (Túrós Rétes)

Crispy phyllo sheets stuffed with sweet cottage cheese, sour cream, and raisins — a Hungarian classic that bakes golden in under 25 minutes. Serve warm with a dusting of powdered sugar for a bakery-quality dinner or brunch.

Total time
24 min
Servings
4
Calories
385
Protein
12g
Cottage Cheese Strudel (Túrós Rétes)
comfortwholesomehungarianvegetariancheesecrispycreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Mix cottage cheese, sour cream, granulated sugar, and raisins in a bowl until combined.

  2. Step 2

    Lay out 1 phyllo sheet on a work surface and brush lightly with melted butter.

  3. Step 3

    Repeat layering and buttering until you have 4 phyllo sheets stacked.

  4. Step 4

    Spread half the cottage cheese filling across the phyllo 2 inches from the bottom edge, leaving a 1-inch border on sides.

  5. Step 5

    Roll tightly from the bottom, tucking in the sides as you go. Transfer seam-side down to a buttered baking sheet.

  6. Step 6

    Repeat with remaining 4 phyllo sheets and filling to make a second roll. Brush both rolls with remaining butter.

  7. Step 7

    Bake 18–20 minutes until golden brown and edges curl. Dust with powdered sugar and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • mixing bowl
  • pastry brush
  • work surface

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.