Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Quick Cheese Strudel (Túrós Rétes)

Crispy phyllo wraps creamy cottage cheese and sugar into a warm, shatteringly crisp pastry — Hungarian comfort in under 25 minutes. No yeast dough required.

Total time
22 min
Servings
4
Calories
320
Protein
9g
Quick Cheese Strudel (Túrós Rétes)
comfortcozyhungarianvegetariancheesecrispycreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix cottage cheese, granulated sugar, egg, and vanilla in a bowl until smooth.

  2. Step 2

    Lay one phyllo sheet on a work surface, brush lightly with melted butter.

  3. Step 3

    Repeat layering and buttering 3 more phyllo sheets, then spread half the cheese mixture along one long edge.

  4. Step 4

    Roll tightly into a log, tucking in the sides. Transfer to a buttered baking sheet seam-side down.

  5. Step 5

    Repeat with remaining phyllo, butter, and cheese filling to make a second roll.

  6. Step 6

    Brush rolls with remaining butter. Bake at 400°F for 12–14 minutes until deep golden.

  7. Step 7

    Cool 2 minutes. Dust with powdered sugar and serve warm.

Tools you’ll need

  • mixing bowl
  • pastry brush
  • work surface (cutting board or clean counter)
  • baking sheet
  • butter knife or small offset spatula
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.