Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Veal Piccata

Tender veal cutlets dredged in flour, pan-seared golden, and finished with a bright lemon-caper sauce. Classic Italian elegance in under 30 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
38g
Veal Piccata
elegantfreshitalianbeeftendercrispyweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place each veal cutlet between plastic wrap and pound thin (1/4-inch) with a meat mallet.

  2. Step 2

    Spread flour on a shallow plate. Season veal with salt and pepper, then dredge both sides in flour, tapping off excess.

  3. Step 3

    Heat olive oil in a 12-inch skillet over medium-high heat until it shimmers, about 90 seconds.

  4. Step 4

    Working in batches if needed, sear veal 90 seconds per side without moving. Veal should be golden; don't overcrowd the pan.

  5. Step 5

    Transfer seared veal to a plate. Reduce heat to medium.

  6. Step 6

    Add lemon juice, capers, and lemon zest to the skillet. Swirl in butter until melted and sauce coats the back of a spoon, about 1 minute.

  7. Step 7

    Return veal to the skillet and turn to coat in sauce. Cook 30 seconds per side.

  8. Step 8

    Divide veal among plates, spoon sauce and capers over top, and sprinkle with fresh parsley. Serve immediately.

Tools you’ll need

  • meat mallet
  • plastic wrap
  • shallow plate
  • 12-inch skillet
  • tongs or fish spatula
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.