Custrd is out on the App Store — Download it free →
Back to recipes

Veal Rolls in Tomato Sauce

Tender veal rolls simmered in a rich tomato sauce, finished with fresh parsley. A quick and comforting weeknight dinner.

Total time
20 min
Servings
4
Calories
320
Protein
28g
Veal Rolls in Tomato Sauce
comfortingItaliangluten-freedairy-freevealtenderweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Season the 4 veal cutlets with 0.5 tsp salt. Roll each slice tightly and secure with a toothpick.

  2. Step 2

    Heat 2 tbsp olive oil in a skillet over medium-high. Add the veal rolls and brown on all sides, about 4 minutes total, until golden.

  3. Step 3

    Add 2 minced garlic cloves and cook for 30 seconds until fragrant. Pour in 2 cups tomato sauce and bring to a simmer.

  4. Step 4

    Reduce heat to low, cover, and simmer for 10 minutes until the veal is tender and the sauce thickens slightly.

  5. Step 5

    Stir in 0.25 cup chopped parsley and serve hot.

Tools you’ll need

  • skillet
  • toothpicks
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.