Custrd is out on the App Store — Download it free →
Back to recipes

Vegetable Salad with Tempeh and Feta

A hearty roasted vegetable salad with crispy tempeh and creamy feta, perfect for a quick weeknight dinner.

Total time
35 min
Servings
4
Calories
380
Protein
18g
Vegetable Salad with Tempeh and Feta
healthycomfortingfusionvegetariantempehfetacrispytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Peel and dice the 2 sweet potatoes and 2 carrots into 1/2-inch cubes. Slice the 2 bell peppers into strips.

  2. Step 2

    On a baking sheet, toss the sweet potatoes, carrots, and bell peppers with 2 tbsp olive oil, salt, and pepper. Roast for 20-25 minutes until tender and lightly charred, stirring once halfway.

  3. Step 3

    While vegetables roast, cut the 8 oz tempeh into 1/2-inch cubes. Heat 1 tbsp olive oil in a skillet over medium-high heat.

  4. Step 4

    Add tempeh to skillet and cook for 8-10 minutes, turning occasionally, until golden brown and crispy on all sides.

  5. Step 5

    In a large bowl, combine the 4 cups baby spinach, roasted vegetables, and crispy tempeh. Drizzle with 2 tbsp lemon juice and toss gently.

  6. Step 6

    Crumble the 4 oz feta over the salad and serve warm or at room temperature.

  7. Step 7

    Optional: add a pinch of cumin or smoked paprika to the tempeh while cooking for extra flavor.

Tools you’ll need

  • baking sheet
  • skillet
  • large bowl
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.