Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Vegetable Stir-Fry Noodles

Fast, wok-style noodles loaded with crisp vegetables and a glossy soy-ginger sauce. Perfect weeknight dinner that comes together in 25 minutes.

Total time
25 min
Servings
4
Calories
378
Protein
10g
Vegetable Stir-Fry Noodles
quicksatisfyingasianvegetarianvegancrispytenderchewy

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil noodles in salted water until tender, ~5 minutes. Drain and set aside.

  2. Step 2

    In a small bowl, whisk together soy sauce, rice vinegar, and sesame oil.

  3. Step 3

    Heat oil in a 12-inch skillet or wok over high heat until it just shimmers, ~60 seconds.

  4. Step 4

    Add garlic and ginger, stirring constantly until fragrant, ~30 seconds.

  5. Step 5

    Add bell pepper, snap peas, and carrots. Stir constantly for 3-4 minutes until vegetables are bright and crisp-tender.

  6. Step 6

    Pour in the sauce and add the cooked noodles. Toss constantly until everything is coated and heated through, ~2 minutes.

  7. Step 7

    Scatter scallions over the top and serve immediately while steam rises from the noodles.

Tools you’ll need

  • large pot or kettle
  • 12-inch skillet or wok
  • small mixing bowl
  • whisk
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.