Custrd is out on the App Store — Download it free →
Back to recipes

Viennese Breaded Veal Cutlet with Salad

A classic Austrian-style breaded veal cutlet, golden and crispy, served with a simple fresh salad of mixed greens, cherry tomatoes, and red onion. Perfect for a quick and satisfying meal.

Total time
25 min
Servings
4
Calories
550
Protein
35g
Viennese Breaded Veal Cutlet with Salad
comfortingclassicAustrianvealcrispytenderweeknight dinnermain course

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pound the 4 veal cutlets to 1/4-inch thickness. Set up three shallow dishes: 0.5 cup flour, 2 beaten eggs, and 1 cup breadcrumbs.

  2. Step 2

    Dredge each cutlet in flour, then egg, then breadcrumbs, pressing firmly to coat. Set aside on a plate.

  3. Step 3

    Heat 1/4 cup oil in a large skillet over medium-high. Fry cutlets in batches until golden brown and cooked through, about 3 minutes per side. Drain on paper towels.

  4. Step 4

    Toss the 4 cups mixed greens and 1 cup halved cherry tomatoes with 2 tbsp olive oil and 1 tbsp vinegar. Season with salt and pepper.

  5. Step 5

    Serve the hot cutlets with the salad, topped with thinly sliced red onion if desired.

Tools you’ll need

  • meat mallet
  • large skillet
  • shallow dishes
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.